PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr8P02960_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 839aa    MW: 92463.5 Da    PI: 6.8921
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr8P02960_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.5e-18663457
                           -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                             ++t+eq+e+Le++++++++ps  +r++L +++    +++ +q+kvWFqNrR +ek+
  GSMUA_Achr8P02960_001  6 YVRYTPEQVEALERVYNECPKPSSLKRQQLIRECpilsNIDPKQIKVWFQNRRCREKQ 63
                           6789****************************************************97 PP

2START165.73.4e-521543612204
                            HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS.SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-SEEEEEEEECTT. CS
                  START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskvdsgealrasgvvdmvlallveellddkeqWdetlakaetlevissg. 88 
                            +aee+++e+++ka+ ++  Wv+++ +++g++++ +++ s+++sg a+ra+g+v  +++  v+e+l+d++ W ++++  ++l vi +g 
  GSMUA_Achr8P02960_001 154 IAEETLAEFLSKATGTAVEWVQMVGMKPGPDSIGIIAVSRNCSGVAARACGLVNLEPT-KVAEILKDRLSWYHDCRCLDVLTVIPTGn 240
                            68999*****************************************************.8999999999******************* PP

                            .EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--....-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE CS
                  START  89 .galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe...sssvvRaellpSgiliepksnghskvtwvehvd 171
                             g ++l +++++a+++l++ Rdf+++Ry+ +l++g++vi+++S+++ +  p     s +vRa++lpSg+li+p+++g+s +++v+hvd
  GSMUA_Achr8P02960_001 241 gGNIELLYMQTYAPTTLASaRDFWILRYTTCLEDGSLVICERSLTPSTGGPVgpaASDFVRATMLPSGYLIRPCEGGGSMMHIVDHVD 328
                            ***************************************************9999********************************* PP

                            --SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXX CS
                  START 172 lkgrlphwllrslvksglaegaktwvatlqrqc 204
                            l+ +++++++r+l++s  + ++k+++a+l++ +
  GSMUA_Achr8P02960_001 329 LDVWSVPEVIRPLYESPEILAQKMTLAALRHIR 361
                            ****************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.467164IPR001356Homeobox domain
SMARTSM003894.1E-15268IPR001356Homeobox domain
CDDcd000867.99E-17565No hitNo description
SuperFamilySSF466891.88E-16566IPR009057Homeodomain-like
PfamPF000463.5E-16663IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.3E-18764IPR009057Homeodomain-like
CDDcd146861.98E-65796No hitNo description
PROSITE profilePS5084824.824144372IPR002913START domain
Gene3DG3DSA:3.30.530.208.9E-21152337IPR023393START-like domain
SMARTSM002341.4E-44153363IPR002913START domain
SuperFamilySSF559611.11E-37154365No hitNo description
PfamPF018528.0E-50154361IPR002913START domain
PfamPF086703.2E-48690838IPR013978MEKHLA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 839 aa     Download sequence    Send to blast
MDAGKYVRYT PEQVEALERV YNECPKPSSL KRQQLIRECP ILSNIDPKQI KVWFQNRRCR  60
EKQKKEACRL QAVNRKLTAM NKLLMEENDR LQKQVSQLVC ENGYMRQQLH NASVATTDTS  120
CESVVTSGQH HHQQNPTPQC PQKDPNNPAG LLAIAEETLA EFLSKATGTA VEWVQMVGMK  180
PGPDSIGIIA VSRNCSGVAA RACGLVNLEP TKVAEILKDR LSWYHDCRCL DVLTVIPTGN  240
GGNIELLYMQ TYAPTTLASA RDFWILRYTT CLEDGSLVIC ERSLTPSTGG PVGPAASDFV  300
RATMLPSGYL IRPCEGGGSM MHIVDHVDLD VWSVPEVIRP LYESPEILAQ KMTLAALRHI  360
RQISQEASGE IAYVGRHQPA VLRNFIRRLS RGFNDAVNGF ADDGWSLMGS DGVEDVTIAI  420
NSSPNKFHRS HFNSSTAFSG IGCGILCAKA SMLLQNVPPA LLVCFLREHR SEWADFGVDA  480
YSASSLRASP YAVPGVRSGS NFVGNQIILP LAHTTEHEET LEVVRIVDHG FNQDDVLSRN  540
IHLLQLCRGV DENAAGACAQ LVFAPIDESF ADDTPLLTSG FRIIPLDSRP DGPKATRTLD  600
LASTLEVGSG AAAHTANKTT CSAFNSRSVM TVAFQFTYEN HLRENVAAMA RQYVRSVVTS  660
VQRVAMAIAP SRLGSHIGAK QPLGSPEAHT LAQWIFRSYR FHIGVDLFQA DSHTSESLLK  720
NLWHHSDAIV CYALKASRLF CVPSIFNFAN QAGLDMLETT HVALQDITLE KILDDSSRKV  780
LNAEFPKIMQ QGFAYLPAGI CSSSMGRPIS YEQVVAWKVL NDVDSPHCLA FMFVNWSFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009412508.10.0PREDICTED: homeobox-leucine zipper protein HOX32-like
SwissprotQ6AST10.0HOX32_ORYSJ; Homeobox-leucine zipper protein HOX32
TrEMBLM0TM480.0M0TM48_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P02960_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37438197
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34710.10.0HD-ZIP family protein